▸ Cosmetic Grade Lyophilized Peptide Powder ▸ Bulk Freeze-Dried Peptide Raw Material ▸ Custom Multi-Peptide Lyophilized Powder ▸ Lyophilized Peptide Vial Kit Private Label ▸ Cosmetic Peptide Formulation Customization ▸ Wholesale Skincare Lyophilized Peptide ▸ Lyophilization Technology for Cosmetic Peptide ▸ Exportable Cosmetic Peptide with Complete Documents ▸
Amyloid β-Protein (1-42) (mouse professional product presentation
Research & Catalog Peptides

Amyloid β-Protein (1-42) (mouse

Amyloid β-Protein (1-42) (mouse - structured B2B product information for research use or qualified development. Grade, specification, documentation and availability are confirmed per inquiry.

CAS166090-74-0Use scopeResearch use or qualified development
Identity & Specification

Product Parameters

Catalog numberConfirm against the current product specification
CAS number166090-74-0
SequenceH-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
One-letter sequenceNH2-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Molecular formulaConfirm against the current product specification
Molecular weight4418.01
Available purityConfirm against the current product specification
AppearanceConfirm against the current product specification
Storage guidanceConfirm against the current product specification

Supply and Quality Options

Format

Lyophilized powder, bulk material, development sample or custom-filled vial, subject to technical feasibility.

Quality package

Product specification and batch COA; TDS, SDS and analytical support are confirmed by product and project.

Custom development

Purity, salt form, fill quantity, packaging, testing and scale can be reviewed for qualified B2B projects.

Shipping

Packaging and temperature controls are selected against material stability, route, season and destination requirements.

Product Overview

This catalog entry supports qualified B2B sourcing and technical evaluation. Identity data is organized for product matching; final salt form, purity, analytical methods, manufacturing grade, packaging and regulatory documentation are confirmed against the current quotation and quality agreement.

Documentation Available for Review

  • Current product specification and identity confirmation
  • Batch-specific certificate of analysis where applicable
  • Analytical documentation aligned to the agreed quality package
  • Storage, packaging and shipment guidance
  • GMP, sterile or injectable-development documentation when specifically applicable and contracted

Request Current Specification

Professional-use and regulatory notice

For laboratory research or qualified development unless a different grade and regulatory pathway are expressly confirmed in the quotation and quality agreement. Not offered as a consumer product.